PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 437aa    MW: 48303.8 Da    PI: 7.4099
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027897genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.95.8e-15324376557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +  e+ ++ +
  Lus10027897 324 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKELNEELERKQAEIMQMQQ 376
                  79************************************988887777777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-12320384IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737322373IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11324374IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.5E-14324372No hitNo description
SuperFamilySSF579598.44E-10324373No hitNo description
CDDcd147072.00E-24324378No hitNo description
PROSITE patternPS000360327342IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MGSHFNFSSF GNPANSPLVR QQSSVYSLTF DELQNTWGGS IGGKDFGSMN MDELLKNICT  60
AEETSTIGVV EEAGTGNLQR QGSLTLPRTL SQKTVDEVWK DFIKENSVAA AAKDVTQPPD  120
DPMLMPQRQR TLGEMTLEEF LLRAGVVREE NNNNNNKQQF GRPSNVGFFG ESAQLNGGDH  180
SGLALGFQPS NRENIINNNS FLANQGSNLG LNVGGIRPPP HQQLHQQSTL HRSRNQPRHQ  240
QQQQPLLFPK PAHVPFASPV HNKINGGRSS AAGVTVATAS PASQKSPDVL SRSDADTLSV  300
SPVPYVFSSR GRRPNTALEK VVERRQRRMI KNRESAARSR ARKQAYTLEL EAEVAKLKEL  360
NEELERKQAE IMQMQQNQGV HLDARIVYRS EFHCDFAVLG ENEASMGRQA ALLEEDTDRA  420
MVESQDQLDI VSKHRV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313119.11e-131hypothetical protein POPTR_0009s10400g
SwissprotQ9M7Q28e-93AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLB9HS141e-130B9HS14_POPTR; Uncharacterized protein
STRINGPOPTR_0009s10400.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.21e-78abscisic acid responsive element-binding factor 1